logo
 
Displaying 32731 - 32760 of 106926 total results
defenceministerasksnavytomaintainfocusonfuturisticcapabilitydevelopmentinmaritimedomain

Defence Minister asks navy to maintain focus on futuristic capability development in maritime domain

New Delhi: Defence Minister Rajnath Singh has asked naval commanders to maintain focus on futuristic capability development for effectively overcoming...

telanganarecords9313%pollinginbyelection

Telangana records 93.13% polling in byelection

Munugode Assembly constituency reported 93.13 percent in by-poll in Telangana. The office of the Telangana Chief Electoral Officer stated that over 2 ...

twononlocallabourersshotatandinjuredbyterroristsinanantnagjk

Two non-local labourers shot at and injured by terrorists in Anantnag, J&K

Srinagar: In the Union Territory of Jammu and Kashmir, terrorists fired upon two non-local labourers, in south Kashmir's Anantnag district last evenin...

delhimetrorailservicesonairportexpresslinetobeslightlyaffectedbynovemberend

Delhi metro rail services on Airport Express Line to be slightly affected by November end

New Delhi: The metro rail services on the Airport Express Line will be slightly affected between 11 PM to 7 AM by the end of this month due to the ong...

mangets15daysinjailandfineforabusingtrafficsiduringthechecking

Man gets 15 days in jail and fine for abusing traffic SI during the checking

A local court sentenced a man to 15 days imprisonment for abusing a traffic sub-inspector (SI) when the latter asked him to clear pending challans.G. ...

scufflebetweenneighboursoverlightingdiyasinhyderabadcasehasbeenregistered

Scuffle between neighbours over lighting diyas in Hyderabad, case has been registered

A case has been registered by the Chikkadpally police against a family for entering into argument with a neighbouring family over lighting of diyas du...

presidentdroupadimurmutolaunchseveralcentralandstategovernmentprojectsinsikkimtoday

President Droupadi Murmu to launch several central and state government projects in Sikkim today

Gangtok: President Droupadi Murmu is scheduled to arrive in Sikkim today on a two-day visit. She will inaugurate and lay the foundation for various ce...

commissionforairqualitymanagementbansentryoftrucksconstructionactivitiesinncrtoimproveairquality

Commission for Air Quality Management bans entry of trucks, construction activities in NCR to improve air quality

New Delhi: In the wake of deteriorating air quality in the National Capital Region, the Commission for Air Quality Management has taken several measur...

teenagerfoundhanginginpolicestation;officerinchargesuspendedinjharkhand

Teenager found hanging in police station; officer-in-charge suspended in Jharkhand

Jharkhand: The officer-in-charge of a police station in Jharkhand's Seraikela-Kharswan district was suspended on Thursday after an 18-year-old man, wh...

a12yearoldgirldiedundergoingtreatmentwhosustainedburnswhilelightingcrackersondiwali

A 12-year-old girl died undergoing treatment who sustained burns while lighting crackers on Diwali

A 12 year-old girl who sustained burns while lighting crackers on Diwali passed away while undergoing treatment Wednesday night.According to the polic...

cabinetnodfortrackingdevicesandemergencypanicbuttonsinpublicvehiclesinkarnataka

Cabinet nod for tracking devices and emergency panic buttons in public vehicles in Karnataka

Bengaluru:The Karnataka cabinet on Thursday approved the installation of vehicle location tracking devices and emergency panic buttons in all public t...

couplewithillkidstoppedandfinedbycopsfornotwearinghelmetinkarnataka

Couple with ill kid stopped and fined by cops for not wearing helmet in Karnataka

Mandya: In a shocking incident reported from Mandya, a couple who were rushing to a hospital for the treatment of their ailing seven-month-old child w...

using‘magicpen’twosuspectsdupemanybytakingcancelledchequessigned

Using ‘magic pen’, two suspects dupe many by taking cancelled cheques signed

Noida: The Gautam Budh Nagar police on Wednesday arrested two suspects for allegedly duping several people by posing as bank executives and taking can...

muttontocostmoreinhyderabadlikelytotouchrs1000mark

Mutton to cost more in Hyderabad, likely to touch Rs 1,000-mark

Mutton prices are likely to skyrocket in the city after Karthika Masam due to high demand and supply shortage, traders say. This comes as a double blo...

imrankhanaccusesshehbazsharifarmymajorgeneralfaisalamong3peopleforattackathisrally

Imran Khan accuses Shehbaz Sharif, Army Major General Faisal, among 3 people for attack at his rally

Imran Khan has accused Pakistan Prime Minister Shehbaz Sharif, Rana Sanaullah and Major General Faisal for attack at his rally in Pakistan's Wazirabad...

gujaratassemblypollstohave2phasevotingondec15;resultsondec8:ec

Gujarat Assembly polls to have 2-phase voting on Dec 1, 5; results on Dec 8: EC

The dates for the high-intensity Gujarat poll have been announced. The state will go to polls in two phases on December 1 and 5 and the results will b...

israelelections:pmyairlapidconcedesdefeattobenjaminnetanyahu

Israel elections: PM Yair Lapid concedes defeat to Benjamin Netanyahu

Former Israeli Prime Minister Yair Lapid conceded defeat to Benjamin Netanyahu on Thursday. Lapid congratulated his opponent and said, "The State of I...

formerpakpmimrankhanhisaideinjuredingunattackduringrallyinwazirabad

Former Pak PM Imran Khan, his aide injured in gun attack during rally in Wazirabad

Former Pakistan PM Imran Khan was injured in his leg in a firing on Thursday during his 'real freedom' rally in Wazirabad. The incident happened at Za...

twitterissimplythemostinterestingplaceontheinternet:elonmusk

Twitter is simply the most interesting place on the Internet: Elon Musk

New York: A day after announcing plans to charge a monthly fee for Twitter’s blue tick verification, the social media company’s new owner Elon Musk sa...

raajkumaranandtakesoathasdelhiminister

Raaj Kumar Anand takes oath as Delhi minister

New Delhi: Aam Aadmi Party MLA Raaj Kumar Anand was on Thursday administered oath as a minister in the Delhi government by Lieutenant Governor VK Saxe...

over25%pollinginmunugodebypolltill11am

Over 25% polling in Munugode by-poll till 11 AM

Hyderabad: Over 25 per cent polling was reported till 11 AM in the by-poll to the Munugode Assembly constituency in Telangana on Thursday.The polling ...

twophasepollsingujaratondec15

Two phase polls in Gujarat on Dec 1, 5

New Delhi: Gujarat will go to polls in two phases on December 1 and 5 with the counting of votes on December 8 along with that of Himachal Pradesh, Ch...

hmdatoholdprebidmeetingforauctionofplotsfromnovember3

HMDA to hold pre-bid meeting for auction of plots from November 3

The Hyderabad Metropolitan Development Authority (HMDA) would be holding pre-bid meeting for auction of plots in different layouts, starting November ...

scrtorunspecialtrainsonvariousdestinations

SCR to run special trains on various destinations

The South Central Railway (SCR) will run special trains between various destinations.These special trains include Secunderabad- Tirupati and Tirupati ...

formulaeracetracktobereadybynovemberendinhyderabad

Formula E race track to be ready by November-end in Hyderabad

Ahead of the Formula E race in the city next year, Urban Development Special Chief Secretary Arvind Kumar on Wednesday inspected the ongoing works und...

ktrurgesthepeopletotakeawisedecisioninmunugodebyelectionandteachabefittinglessontothebjpforitsanarchy

KTR urges the people to take a wise decision in Munugode by-election and teach a befitting lesson to the BJP for its anarchy

Minister KT Rama Rao said violence has no place in a democracy. He urged the people to take a wise decision in Munugode by-election and teach a befitt...

thereisnoofficialcommunicationorinvitationtothechiefminister’sofficeaboutthepmsvisittoramagundam

There is no official communication or invitation to the Chief Minister’s Office about the PM's visit to Ramagundam

Prime Minister Narendra Modi is scheduled to visit Ramagundam to dedicate the Ramagundam Fertilisers and Chemicals Limited on November 12. However, ti...

andhrapradeshdefersbanonplasticflexistojan26

Andhra Pradesh defers ban on plastic flexis to Jan 26

Amaravati: The Andhra Pradesh government has deferred the implementation of the ban on plastic flexi banners from November 1 this year to January 26 n...

moditolaunchprojectsworthrs10850croreinvisakhapatnam

Modi to launch projects worth Rs 10,850 crore in Visakhapatnam

Visakhapatnam: Prime Minister Narendra Modi will launch at least eight projects worth Rs.10,842.47 crore during his visit to the city on November 12.B...

prakashutsavtobeheldintelanganafromnovember4to8

Prakash Utsav to be held in Telangana from November 4 to 8

Sri Guru Nanak Dev Ji birthday celebrations (Prakash Utsav) will be held on a grand scale in Telangana from November 4 to 8.To mark the 553rd birth ce...

Displaying 32731 - 32760 of 106926 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Which team will win the ICC Men's Champions Trophy 2025 held in Pakistan/Dubai?

Australia
India
New Zealand