logo
 
Displaying 4261 - 4290 of 108073 total results
videooffirebreaksoutnearmalakpetmetrostation

Video of fire breaks out near Malakpet metro station

A fire broke out near Malakpet metro station in Hyderabad on Friday, December 6 after a few bikes caught fire sending thick smoke into the air and rai...

delhirecordsmoderateairquality

Delhi records 'moderate' air quality

New Delhi: Delhiites woke up to cleaner skies for the third consecutive day as the city's air quality remained in the 'moderate' category on Friday.At...

currencyfoundfromseatallottedtocongmpsinghvi:rschairdhankhar

Currency found from seat allotted to Cong MP Singhvi: RS chair Dhankhar

New Delhi: Rajya Sabha Chairman Jagdeep Dhankhar on Friday said a wad of currency notes was recovered by security staff from the seat allotted to Cong...

srinagarrecordsseason’scoldestnightat41degreesc

Srinagar records season’s coldest night at -4.1 degrees C

Srinagar: Jammu and Kashmir‘s capital Srinagar recorded its coldest night of the season as the minimum temperature dropped to minus 4.1 degrees Celsiu...

mallikarjunkhargedissolvesentirestatecongresscommitteesinuttarpradesh

Mallikarjun Kharge dissolves entire state Congress committees in Uttar Pradesh

New Delhi: Congress president Mallikarjun Kharge has dissolved the pradesh, district, city and block committees of the party’s Uttar Pradesh unit with...

pmmodipaystributestoambedkarondeathanniversary

PM Modi pays tributes to Ambedkar on death anniversary

New Delhi: Prime Minister Narendra Modi on Friday paid tributes to the main architect of the Constitution, B R Ambedkar, on his death anniversary, say...

massivefirebreaksoutingandhisagarwildlifesanctuaryinmp

Massive fire breaks out in Gandhi Sagar Wildlife Sanctuary in MP

Bhopal: Gandhi Sagar Wildlife Sanctuary, which is all set to become the second destination for cheetahs in Madhya Pradesh, witnessed a massive fire on...

telanganahighcourtupholdsmergerof51grampanchayats

Telangana High Court upholds merger of 51 gram panchayats

The two judge bench of the Telangana High Court comprising Chief Justice Alok Aradhe and Justice J. Sreenivas Rao has upheld the merger of 51 gram pan...

farmerssettobegindelhimarchat1pm

Farmers set to begin Delhi march at 1 pm

Chandigarh: A ‘jatha’ (group) of 101 farmers will embark on a foot march to Delhi at 1 pm on Friday from their protest site at the Shambhu border on t...

brsmlapadikaushikreddyreleasedonbail

BRS MLA Padi Kaushik Reddy released on bail

BRS Huzurabad MLA Padi Kaushik Reddy, who was arrested on Thursday morning, was granted bail after midnight following a day-long dramatic sequence of ...

educationministerdharmendrapradhantolaunchpmevidyadthchannelforindiansignlanguage

Education Minister Dharmendra Pradhan to launch PM e-VIDYA DTH Channel for Indian Sign Language

Union Minister for Education Dharmendra Pradhan will launch the PM e-VIDYA DTH Channel No. 31 for Indian Sign Language in New Delhi today. The event w...

indiaegypthold13throundoffocinnewdelhi

India, Egypt hold 13th round of FOC in New Delhi

India and Egypt held the 13th round of Foreign Office Consultations FOC in New Delhi yesterday. It was co-chaired by the Secretary (Consular, Passport...

indiachinaholddiplomatictalksreviewsituationinborderareas

India, China hold diplomatic talks, review situation in border areas

India and China have agreed on the need for effective border management and maintenance of peace and tranquillity in accordance with relevant bilatera...

parliamentgivesitsnodtobharatiyavayuyanvidheyak2024

Parliament gives its nod to Bharatiya Vayuyan Vidheyak 2024

The Parliament has given its nod to the Bharatiya Vayuyan Vidheyak 2024 with the Rajya Sabha passing it yesterday. The Lok Sabha has already passed th...

isrolaunchespslvc59carryingesa’sproba3fromsriharikota

ISRO launches PSLV C-59 carrying ESA’s PROBA-3 from Sriharikota

ISRO yesterday successfully launched the PSLV C-59 launch vehicle carrying PROBA 3 spacecraft into a highly elliptical orbit at Satish Dhawan Space Ce...

pmmodimeetsbhutanskingkhesarnamgyelwangchuckinnewdelhi

PM Modi meets Bhutan's King Khesar Namgyel Wangchuck in New Delhi

Bhutan’s King Jigme Khesar Namgyel Wangchuck and Queen Jetsun Pema Wangchuck yesterday met Prime Minister Narendra Modi in New Delhi. During the meeti...

railwaysministerashwinivaishnawinspectsnewlybuiltroadcumrailvehicle

Railways Minister Ashwini Vaishnaw inspects newly built road-cum-rail vehicle

Railways Minister Ashwini Vaishnaw yesterday inspected a newly built road-cum-rail vehicle at the New Delhi Railway Station premises. Talking to the m...

northkorearussiatreatycomesintoforce:kcna

North Korea-Russia treaty comes into force: KCNA

The Comprehensive Strategic Partnership Treaty agreed upon by the leaders of North Korea and Russia in June came into force yesterday with the exchang...

unurgestalibantoreconsiderimplementingrestrictionsonwomen’saccesstomedicaltraining

UN urges Taliban to reconsider implementing restrictions on women’s access to medical training

The United Nations urged the Taliban authorities to reconsider implementing restrictions on women’s and girls’ access to medical training in Afghanist...

drconhighalertasmysteriousdiseaseclaimsover70lives

DRC on High Alert as Mysterious Disease Claims Over 70 Lives

The Democratic Republic of the Congo (DRC) is on high alert over the emergence of an unknown disease that has killed more than 70 people. DRC Public H...

syrianrebelscapturekeycityofhama

Syrian rebels capture key city of Hama

Syrian rebels captured the key city of Hama today, bringing the rebels a major victory after a lightning advance across northern Syria. After capturin...

70earthquakehitscalifornia

7.0 earthquake hits California

In the United States, an earthquake with a magnitude of 7 on the Richter scale shook parts of Northern California, temporarily forcing a tsunami warni...

copernicussentinel1csatellitelaunchedaboardvegacrocket

Copernicus Sentinel-1C satellite launched aboard Vega-C rocket

The third Copernicus Sentinel-1 satellite was launched last night aboard a Vega-C rocket from Europe’s Spaceport in French Guiana. The launch marked t...

frenchpresidentmacrontonamenewpmincomingdays

French President Macron to name new PM in coming days

French President Emmanuel Macron said he will name a new Prime Minister in the coming days after Michel Barnier resigned following a no-confidence vot...

supremecourtallowsgrapivrestrictionstoberelaxeduptograpii

Supreme Court allows GRAP-IV restrictions to be relaxed upto GRAP-II

The Supreme Court has allowed the Commission for Air Quality Management to relax the Graded Response Action Plan (GRAP) Stage-IV restrictions in Delhi...

jharkhand:11ministersinductedintohemantsorenledcabinet

Jharkhand: 11 ministers inducted into Hemant Soren-led cabinet

In Jharkhand, the council of ministers of the Hemant Soren-led government took oath today. Governor Santosh Kumar Gangwar administered the oath of off...

deadlineforviksitbharatquizchallengeextendedtodec10

Deadline for Viksit Bharat Quiz Challenge extended to Dec 10

Union Minister of Youth Affairs and Sports Dr Mansukh Mandaviya has announced the extension of the date of participation for the ongoing Viksit Bharat...

indiaandrwandaholdsecondforeignofficeconsultationsinnewdelhi

India and Rwanda Hold Second Foreign Office Consultations in New Delhi

The Second India-Rwanda Foreign Office Consultations were held in New Delhi yesterday. The Indian side was led by Joint Secretary (East and Southern A...

india’snuclearpowerplantsamongthesafestintheworld:drjitendrasingh

India’s nuclear power plants among the safest in the world: Dr Jitendra Singh

Minister of State for Atomic Energy  Dr Jitendra Singh yesterday said that  India’s nuclear power plants are among the safest in the world, ...

nationobservesmahaparinirvandiwastoday

Nation observes Mahaparinirvan Diwas today

Mahaparinirvan Diwas is being observed today, marking the 69th death anniversary of Bharat Ratna Dr BR Ambedkar, the chief architect of the Indian Con...

Displaying 4261 - 4290 of 108073 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Do you think Canada-India relations will improve under New PM Mark Carney?

Yes
No
Can't Say