logo
 
Displaying 13201 - 13230 of 25712 total results
economicrecoverymaystretchtilltheendof2021:usfedchiefpowell

Economic recovery may stretch till the end of 2021: US Fed Chief Powell

The US economy will recover from the COVID-19 pandemic, but the process could stretch through until the end of 2021, Federal Reserve Chairman Jerome P...

despitelockdownsugarmillscontractfor42milliontonnesofexports

Despite lockdown, sugar mills contract for 4.2 million tonnes of exports

Amid the twin headwinds of lockdown and falling sugar demand, the domestic sugar mills have contracted for exports totalling 4.2 million tonnes (MT) t...

ukdrugmakeraimsfor30millioncoronavirusvaccinedosesbyseptember

UK drugmaker aims for 30 million coronavirus vaccine doses by September

AstraZeneca Plc will make as many as 30 million doses of vaccine available to the UK by September and has committed to delivering 100 million doses th...

122countrieswantaninvestigationintohowthecoronavirusoutbreakhappenedbutchinasaysitspremature

122 COUNTRIES WANT AN INVESTIGATION INTO HOW THE CORONAVIRUS OUTBREAK HAPPENED, BUT CHINA SAYS ITS 'PREMATURE'

A spokesperson for China's foreign ministry has said it is too early to allow an independent investigation into the origins and spread of the COVID-19...

chinaaskedfoodcompaniestoboostsupplyinfearofsecondwaveofcoronavirus

China asked food companies to boost supply in fear of second wave of Coronavirus

China has asked trading firms and food processors to boost inventories of grains and oilseeds as a possible second wave of coronavirus cases and worse...

morethan10firefightersinjuredinlosangelesbuildingexplosion

More than 10 firefighters injured in Los Angeles building explosion

Eleven firefighters in the United States have been injured after a fire in a commercial building caused an explosion and spread to nearby structures, ...

uscomedianfredwillardpassesawayaged86

US comedian Fred Willard passes away aged 86

Four-time Emmy award-winning comedian Fred Willard, who appeared in films including "Anchorman" and "This is Spinal Tap" and television shows such as ...

thirteenussailorsinfectedwithcovid19testpositiveforasecondtime

Thirteen US sailors infected with Covid-19 test positive for a second time

All the sailors had previously tested positive for the virus and had gone through at least two weeks of isolation.Before they were allowed to go back ...

worldfoodprogrammesays93millionpeoplefoodinsecureinwartornsyria

World Food Programme Says, 9.3 Million People Food Insecure in War-torn Syria

A record 9.3 million people are now food insecure in Syria as spiralling prices and the coronavirus pandemic compound the damage of a nine-year war, t...

vijaymallyaofferstorepayhisloandues:pleasetakemymoneyunconditionallyandcloseit

Vijay Mallya offers to repay his loan dues: Please take my money unconditionally and close it

London: Vijay Mallya has once again offered to repay his loan amount dues to the government. Tweeting about the same he asked the government to accept...

europeancountriesdeclaredcovid19isoveropenborders

European countries declared Covid-19 is over, open borders

Slovenia opened its borders today after declaring an end to its coronavirus epidemic, despite new infections still being reported."Today Slovenia has ...

usprezdonaldtrumprulesoutrenegotiatingtradedealwithchina

US Prez Donald Trump rules out renegotiating trade deal with China

US President Donald Trump has ruled out renegotiating the trade deal with China. He expressed disappointment over Beijing's handling of the coronaviru...

wtochiefrobertoazevedodecidestoresignayearbeforehistermexpires

WTO Chief Roberto Azevedo decides to resign a year before his term expires

The Head of the World Trade Organization (WTO) Roberto Azevedo has decided to resign, a year before his term expires. Mr Azevedo, a former diplomat fr...

fivekilled14injuredineasternafghancityblast

Five killed, 14 injured in eastern Afghan city blast

A truck packed with explosives blew up near a court in the eastern Afghan city of Gardez on Thursday, killing at least five people, two days after gun...

firstcoronavirusantibodytestapprovedinukis100%accurate

First coronavirus antibody test approved in UK is '100% accurate'

Public Health England (PHE) said scientific experts at its Porton Down facility had carried out an independent evaluation of the new coronavirus blood...

typhoonforcesriskyevacuationsincoronavirushitphilippines

Typhoon forces risky evacuations in coronavirus-hit Philippines

powerful typhoon hit the central Philippines Thursday, forcing a complicated and risky evacuation for tens of thousands already hunkered down at home ...

coronavirus‘maynevergoaway’couldbecomeanendemicsayswho

Coronavirus ‘may never go away’, could become an endemic, says WHO

The World Health Organization on Wednesday said the novel coronavirus “may never go away” and that people will have to learn to live with it. Covid-19...

morethan300lawmakersurgeimfworldbanktocanceldebtofpoorcountriesamidpandemic

More Than 300 Lawmakers Urge IMF, World Bank to Cancel Debt of Poor Countries Amid Pandemic

Over 300 lawmakers from around the world on Wednesday urged the International Monetary Fund and World Bank to cancel the debt of the poorest countries...

spain’soldestwoman113overcomescovid19

Spain’s oldest woman, 113, overcomes COVID-19

A 113-year-old woman, believed to be the oldest person living in Spain, has beaten the coronavirus at a retirement home where several other residents ...

coronavirus:japanesesumowrestlerdiesat28

Coronavirus: Japanese sumo wrestler dies at 28

A 28-year-old Japanese sumo wrestler infected with the virus has died, the Japan Sumo Association (JSA) has announced, the first in the sport to fall ...

twittermakesitofficialtoletemployeesworkfromhomeforever

Twitter makes it official to let employees work from home 'forever'

San Francisco: Twitter has made it official to let its employees work from home forever if they chose to and they will be paid like a normal working d...

russiasaysitwillopposeanyusattemptstoextendarmsembargooniran

Russia says it will oppose any US attempts to extend arms embargo on Iran

Russia has said it will oppose any attempts by the United States to extend the arms embargo on Iran and reimpose UN sanctions against the Islamic Repu...

unchiefextendstelecommutingarrangementsatworldbodyshqsthroughjune30

UN chief extends Telecommuting arrangements at world body's HQs through June 30

United Nations chief Antonio Guterres has extended the telecommuting arrangements at the world body's headquarters through June 30 in the wake of the ...

wuhantotestentirepopulationof11masuptickincasespromptsalarmatpossiblesecondwave

Wuhan to test entire population of 11m as uptick in cases prompts alarm at possible second wave

The Chinese city of Wuhan, the epicentre of China’s coronavirus outbreak, plans to conduct city-wide nucleic acid testing over a period of 10 days, ac...

whowarnscountriesforreopeningoftheireconomieswithoutsettingupstrongcontacttracing

WHO warns countries for reopening of their economies without setting up strong contact tracing

A top world health official has warned that countries are essentially driving blind in reopening their economies without setting up strong contact tra...

saudiarabiatriplesvattosupportcoronavirushiteconomy

Saudi Arabia triples VAT to support coronavirus-hit economy

Saudi Arabia is tripling its value added tax (VAT) as part of austerity measures to support its coronavirus-hit economy.The government in Riyadh also ...

fourbacktobackbombexplosionsrockkabul:police

Four back-to-back bomb explosions rock Kabul: Police

Kabul: Four back-to-back roadside bombs exploded in a northern district of Afghanistan’s capital Kabul on Monday, wounding four civilians including a ...

popecallsforeusolidaritytodealwithvirus

Pope calls for EU solidarity to deal with virus

Vatican City: Pope Francis is calling on leaders of European Union countries to work together to deal with the social and economic consequences of the...

uspreztrumpdiscussesdevelopmentsindefeatingcovid19withworldleaders

US Prez Trump discusses developments in defeating Covid-19 with world leaders

United States President Donald Trump reached out to several world leaders, including those from Germany and Saudi Arabia, to discuss the Corona virus ...

atleast65killedinrwandaflooding

At least 65 killed in Rwanda flooding

In Rwanda, at least 65 people were killed in flooding and landslides after overnight heavy rains. Nearly 100 homes were washed away.The Ministry of em...

Displaying 13201 - 13230 of 25712 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Which cricket team is your favourite to win the T20 World Cup 2026?

India
South Africa
New Zealand